PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_CC5803BED.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 382aa    MW: 41459.1 Da    PI: 9.7745
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_CC5803BED.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-17108155148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Traes_4AL_CC5803BED.1 108 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 155
                            79******************************99************97 PP

2Myb_DNA-binding60.34.1e-19161205147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg++T+eEdel+++++++lG++ W++Ia +++ gRt++++k++w+++
  Traes_4AL_CC5803BED.1 161 RGNFTEEEDELIIKLHELLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 205
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-2499158IPR009057Homeodomain-like
PROSITE profilePS5129417.087103155IPR017930Myb domain
SuperFamilySSF466896.7E-30107202IPR009057Homeodomain-like
SMARTSM007177.4E-14107157IPR001005SANT/Myb domain
PfamPF002493.9E-15108155IPR001005SANT/Myb domain
CDDcd001672.43E-11110155No hitNo description
PROSITE profilePS5129429.51156210IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-28159210IPR009057Homeodomain-like
SMARTSM007172.0E-18160208IPR001005SANT/Myb domain
PfamPF002492.5E-17161205IPR001005SANT/Myb domain
CDDcd001673.53E-14163206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MAQRDPRQWG PAPLHPHPPP PRIKPTTHPR LPSLSPPRSL ALKKLARTHA PPTPHRSSFP  60
SDPPTATTAY IISPLLVCGA AGSCLQRTYV PAGGMGRSPC CEKAHTNKGA WTKEEDQRLI  120
AYIKAHGEGC WRSLPKAAGL LRCGKSCRLR WINYLRPDLK RGNFTEEEDE LIIKLHELLG  180
NKWSLIAGRL PGRTDNEIKN YWNTHIKRKL LARGMDPHTH RPLNAIAGAA MPAQQLRVAH  240
QHQYAAATPG GHHLQPQQQD PFAALSSSAE PACSHSSDDE PAGSATPPPP SRRHLGIDLN  300
LSISLAPYQP DDPAVKQEAA TTASHNNATT STSAACMCLN RLGFQGAGEG CRCGGASSVP  360
MQQQASTQHM FRFIAPLEGG RQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-311082107108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0547581e-166BT054758.1 Zea mays full-length cDNA clone ZM_BFb0028G03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697509.11e-125PREDICTED: myb-related protein 308
SwissprotP813958e-91MYB30_ANTMA; Myb-related protein 330
TrEMBLW5DTP10.0W5DTP1_WHEAT; Uncharacterized protein
STRINGMLOC_65957.11e-174(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-88myb domain protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]